This is a Digital Marketing Project. In it we have to create a website for any r

This is a Digital Marketing Project. In it we have to create a website for any random business using Dreamweaver. The site should have basics like attractive landing page with functional buttons and related images and info. To create a website using dreamweaver according to the framework. I need a website built for a college project. I have attached screenshots of the framework in the instructions docx. The phase 2 rubric also has the requirements. I have also attached another past project for reference. Connect with me for any queries. If you can create a website based on the topic in the blueprint screenshots in instructions word doc that would be great. I would need files of the website, as well as a blueprint ppt. I have also attached a zip file named something sweet website. That is past students project to be taken as an example.

A6c. Course Information Approaching Competence Approaching Competence: The mobil

A6c. Course Information
Approaching Competence
Approaching Competence: The mobile application only allows the user to enter, or edit, or delete parts of each course’s information.
EVALUATOR COMMENTS: ATTEMPT 2
The functionality to update and delete existing course notes was not evident. The course notes do not appear to save. Tested using Pixel series emulators / APIs 29, 30
A6f. Alerts for Courses
Approaching Competence
Approaching Competence: The mobile application allows the user to set alerts for either the start or the end date of each course, or the alerts do not trigger when the application is not running.
EVALUATOR COMMENTS: ATTEMPT 2
The ability to set alerts for courses was not observed. Tested using Pixel series emulators / APIs 29, 30
A7a. Assessments for each Course
Approaching Competence
Approaching Competence: The mobile application allows the user to add performance and objective assessments for each course, but cannot include the title of the assessment and the end date for each assessment.
EVALUATOR COMMENTS: ATTEMPT 2
An indicator that identifies a field as ‘assessment type’ was not evident.
A7c. Alerts for Goal Dates
Approaching Competence
Approaching Competence: The mobile application allows the user to set alerts for either the start or the end dates for each assessment.
EVALUATOR COMMENTS: ATTEMPT 2
The ability to set alerts for assessments was not observed. Tested using Pixel series emulators / APIs 29, 30
C. Student Scheduler and Progress Tracking Application
Approaching Competence
Approaching Competence: The mobile application includes a scheduler but does not include the 11 given implementation requirements.
C1. Interface Requirements
Approaching Competence
Approaching Competence: The mobile application includes up to 4 of the given interface requirements.

This assignment assesses the following module learning outcomes:  Demonstrate k

This assignment assesses the following module learning outcomes:
 Demonstrate knowledge of the object oriented (OO) paradigm by producing software
solutions to simple problems.
 Design a simple OO system using UML class diagram (without using a formal tool)
 Implement and test a simple OO software system using a suitable Integrated
Development Environment (VS code)
 Comprehend and explain object oriented programming concepts
 Code re-use, apply good practice in code design/testing
requires you to review the ideas of superclass and
subclass relationship and provide opportunities to examine your level of knowledge in basic
hierarchical class design and object-oriented programming using Python.

Create: Query 1: Contact ID (All contacts), Type of contact, Last Name, First Na

Create:
Query 1: Contact ID (All contacts), Type of contact, Last Name, First Name, Company Name, (Query Name – ContList)
Query 2: Contact ID (All contacts), Type of Contact, Last Name, First Name, Type of Phone, Phone # (Query Name – ContPhone)
Query 3: Contact ID (Business contacts), Business or Service Provider Organization Name, Business or Service Provider type, Business Contact Person, Phone # (Query Name – BsnsContacts)
Query 4: Contact ID (Individuals only), Last Name, First Name, City of Residency, State of Residency, Type of Phone, Phone Number, Email Address (Query Name – IndivContacts)
Query 5: Contract ID (All Contacts), Last Name or Business Name, Phone Number, Email Address
You will be using each of these queries to create a report with all data elements included in the Query. Add a title to each Report, using an expansion of the Query name. So the title for Report 1 would be an expansion of ContList, or Contact List Report. Insert page numbers in the footer of each page of each report.
Report 1. Construct one report from the entire database. Save this report as “2016Business”
Report 2: Construct a report using Query 1 save this as Report “ContList”
Report 3: Construct a report using Query 2 save this as Report “ContPhone”
Report 4: Construct a report using Query 3 save this as Report “BsnsConacts”
Report 5: Construct a report using Query 4 save this as Report “IndivContacts”
Report 6: Construct a report using Query 5 save this as Report “ContactEmail”

q1: Load the trajectory file in VMD ( the files you need are in a compressed fol

q1:
Load the trajectory file in VMD ( the files you need are in a compressed folder on blackboard).
Calculate the RMSD, contact map along the trajectory time. Explain what the RMSD, contact map are, and what information they provide. (10 points)
Calculate the distance between residue 56 atom O and residue 290 atom CA. (5 points)
Calculate the Phi and Psi angles of residue 299 along the trajectory time. (10 points)
q2: Go to the PDB databank and download the structure of 2HHB.
Show in details the steps you need to take to prepare your protein for Molecular Dynamics Simulations. Provide snapshots, save all in a word document
q3: Use MODELLER to generate an initial structural model for the following target sequence:
PIVDSGSVAPLSAAEKTKIRSAWAPVYSNYETSGVDILVKFFTSTPAAQEFFPKFKGMTSADQLKKSADVRWHAERIINA
VNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSAY
In your search, use homologous sequences with known structures for protein in humans (taxid: 9606).
Follow the steps you have learned to generate the best models.
Use the files in the ModelScripts folder to run modeller, and document carefully your input and output results in a separate word document.
To test your model compare it with the chain A of PDB code 1UC3.
Answer questions in complete sentences wherever possible, and insert screenshots when necessary in a word document

donot use jquery or bootsstrap please. please donot copy paste codes from browse

donot use jquery or bootsstrap please. please donot copy paste codes from browser. Please read the step by step guide for assignment i will upload and the assignment specification carefully.
Comments from Customer
Hi there, please read the instructions on the specification and assignment worksheet properly. Its got all the information that is needed. Please donot copy paste codes or use j query or bootstrap kindly. No plagarism please. The assignment worksheet that i have uploaded has all step by step guide of how to proceed with the assignment. Please follow that, and to help it gives examples as well.
Also i uploaded two screenshots of drafts that i am meant to use according to my tutor for html and java scrip page. Please continue from them. For html, start from my draft and the same from java script. I hope i have made myself clear.
One main thing is that, please use prompt boxes in java script like mentioned on assignment worksheet. Thankyou:)